(data stored in ACNUC1104 zone)

EMBL: AM420293.PE573

AM420293.PE573       Location/Qualifiers
FT   CDS             644799..645149
FT                   /transl_table=11
FT                   /locus_tag="SACE_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99928"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7A4"
FT                   /protein_id="CAL99928.1"
FT                   /translation="MTFDIVALCREQPGPGAMLAAMRAAGAELRVNTIDEAQLIQLYHE
FT                   DGRLMMTTEGARLVQVRGEVRRLLGFDEDVPHPVWWVETRAPGGDPEAEAAARRFTQAL
FT                   VTTSGGVSWSTR"
     MTFDIVALCR EQPGPGAMLA AMRAAGAELR VNTIDEAQLI QLYHEDGRLM MTTEGARLVQ        60
     VRGEVRRLLG FDEDVPHPVW WVETRAPGGD PEAEAAARRF TQALVTTSGG VSWSTR           116
//

If you have problems or comments...

PBIL Back to PBIL home page