(data stored in ACNUC1104 zone)

EMBL: AM420293.PE574

AM420293.PE574       Location/Qualifiers
FT   CDS             645134..646105
FT                   /transl_table=11
FT                   /locus_tag="SACE_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99929"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7A5"
FT                   /protein_id="CAL99929.1"
FT                   /translation="MVDALTGHPAADRETAEAIVVEQDRRVVPLSSWLADAAVTAAAGG
FT                   RVLQVLTPARSRITYPLELLITDGHAQWVVRDGVERFRDGITGEPLRWNGARFTAAEGP
FT                   AAPPVPTRSGSLEVQITTLHAADNALQLGLSTEAAMRALVGAAPAGWGVVEPASEPWSP
FT                   RELTRHCHDRSPEPTNVVVVGGEGEPAAVGSLEVTRVDTGVRERLRLAGPASTAVGQDA
FT                   IEDLAAAVAGKARSMLVASHPGRLDGLRWHTPTMPALPYGILVGHQVVQQRGVEHAQSA
FT                   PAARVRILGLDRGRACWCRLDGGQKAPYELLTDVLRHFGLPD"
     MVDALTGHPA ADRETAEAIV VEQDRRVVPL SSWLADAAVT AAAGGRVLQV LTPARSRITY        60
     PLELLITDGH AQWVVRDGVE RFRDGITGEP LRWNGARFTA AEGPAAPPVP TRSGSLEVQI       120
     TTLHAADNAL QLGLSTEAAM RALVGAAPAG WGVVEPASEP WSPRELTRHC HDRSPEPTNV       180
     VVVGGEGEPA AVGSLEVTRV DTGVRERLRL AGPASTAVGQ DAIEDLAAAV AGKARSMLVA       240
     SHPGRLDGLR WHTPTMPALP YGILVGHQVV QQRGVEHAQS APAARVRILG LDRGRACWCR       300
     LDGGQKAPYE LLTDVLRHFG LPD                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page