(data stored in ACNUC1104 zone)

EMBL: AM420293.PE575

AM420293.PE575       Location/Qualifiers
FT   CDS             complement(646102..646542)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0585"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99930"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7A6"
FT                   /protein_id="CAL99930.1"
FT                   /translation="MGLMDLAEVEAVARRAHAEQVDKAGRPYAEHLAAVADGVRARGGS
FT                   EEQIAAAWLHDAVEDYALSEQWLCEAPLAPQTVDIVLALTKRTGESPEDYAARILATPG
FT                   ARLVKEADLAHNADPARLAALDEQTRERLTGKYAHMRALLGI"
     MGLMDLAEVE AVARRAHAEQ VDKAGRPYAE HLAAVADGVR ARGGSEEQIA AAWLHDAVED        60
     YALSEQWLCE APLAPQTVDI VLALTKRTGE SPEDYAARIL ATPGARLVKE ADLAHNADPA       120
     RLAALDEQTR ERLTGKYAHM RALLGI                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page