(data stored in ACNUC1104 zone)

EMBL: AM420293.PE576

AM420293.PE576       Location/Qualifiers
FT   CDS             complement(646557..647102)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0586"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99931"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7A7"
FT                   /protein_id="CAL99931.1"
FT                   /translation="MHEFLVRHFGEEISHPKLGPIAVRDEVTRDFDIAETFAVDTVRAI
FT                   DSGNPADGLMSGGIVVPKDGSPVHWAPTMPAVEDYVKAVADGERWWSSGGAEPVTEVTY
FT                   YGLLTPGRTRSNPSGVLRRRTAAGNTTDEVFTRNLRWEPTDYFRKYELGHNDDEQVEIT
FT                   PGEAAEFVRRIRSKLAQS"
     MHEFLVRHFG EEISHPKLGP IAVRDEVTRD FDIAETFAVD TVRAIDSGNP ADGLMSGGIV        60
     VPKDGSPVHW APTMPAVEDY VKAVADGERW WSSGGAEPVT EVTYYGLLTP GRTRSNPSGV       120
     LRRRTAAGNT TDEVFTRNLR WEPTDYFRKY ELGHNDDEQV EITPGEAAEF VRRIRSKLAQ       180
     S                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page