(data stored in SCRATCH zone)

EMBL: AM420293.PE577

AM420293.PE577       Location/Qualifiers
FT   CDS             complement(647154..650141)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0587"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99932"
FT                   /db_xref="InterPro:IPR028908"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7A8"
FT                   /protein_id="CAL99932.1"
FT                   /translation="MINPAEIPQIPGDMDALAGHASTLKTAGAAFASTGADVHAKWQGL
FT                   AAVYDAPEAGQLLNATQPVSAVSDTVGGNVETVAGALSTYATTVKPIKARLESLRAQAQ
FT                   TFVSSVEGDDDWREDEGKVNQHNQLLSQVNEAVAEWMEAQRTCANAINAVYGGTQYAAD
FT                   NGDGRRDPNEFGYTKDQLNSALGEGLPWGKAEEHDGGFWGDVGDFFVGIKDGAVQMVTD
FT                   LGALIGYANGEWSWSTAGAAWKGLGTFALALGTYANPLAIVADQTIGLPGFKRGEMGGT
FT                   LLNAGKSIIAYDQWGKGHNGRAAGQATFNIVSAVVGTKGAGAGLKGAGAAIQGGKVAGM
FT                   AAKVGGGMVRAGDFVAKMPTVGELGIKLANKLNIHIPHLGPTPALAGDGPSFGHRVDTD
FT                   IADTRGPDVARMDNGGPRGGGPSVGDGLHHTPDGHHGGGTPPGGNTATDGPRDSGVPDG
FT                   RQPSDSHVGGSHHGNGHVSGDGTTLHNGDRPIDSRTPFDGHTQVEGHAPVDGHTPDGDR
FT                   PDGDHTSSPDGGDPSSTSPAPGADTPALPERLGNQPDGSWVNVEHGTRYDLSPEMNAAV
FT                   DRYLGGASVTEGHVTPHVRSIADGIDGARLQGYPDFVLKGEDSFKRKFAQDLARYPDLS
FT                   PDEILANVKDSVRYTIEMPSRNYTDGVLSAVDDLRARGYENVTFKPTWENPDTYKGVNS
FT                   TWRDPATGRVFELQFHTPDSFKAKMDTHGLYEAERVATDEADRLRAAEAQAEIFRQVDV
FT                   PDHAIDRLHELKQTLEAERAAVDPADHAPPQHPDADGHGHHDGNPAPGPADPGDPAGHG
FT                   DGAGDAAPDWSAVSGTTDVNSKPALHSGTATPEQAQRYVAEHHPYVVDVNVDRFQRGVP
FT                   GSDQNCSRCVRAVDLGFTGTPASALPWPEGPGWGLSSNTFADYARSLGADPAAFRQVSS
FT                   YDDIIGDMTARGEGARGMVYIGRPGSAHVFNVVHDQNGVVFLDGQTGGLALLEKNVNIM
FT                   YLPIGR"
     MINPAEIPQI PGDMDALAGH ASTLKTAGAA FASTGADVHA KWQGLAAVYD APEAGQLLNA        60
     TQPVSAVSDT VGGNVETVAG ALSTYATTVK PIKARLESLR AQAQTFVSSV EGDDDWREDE       120
     GKVNQHNQLL SQVNEAVAEW MEAQRTCANA INAVYGGTQY AADNGDGRRD PNEFGYTKDQ       180
     LNSALGEGLP WGKAEEHDGG FWGDVGDFFV GIKDGAVQMV TDLGALIGYA NGEWSWSTAG       240
     AAWKGLGTFA LALGTYANPL AIVADQTIGL PGFKRGEMGG TLLNAGKSII AYDQWGKGHN       300
     GRAAGQATFN IVSAVVGTKG AGAGLKGAGA AIQGGKVAGM AAKVGGGMVR AGDFVAKMPT       360
     VGELGIKLAN KLNIHIPHLG PTPALAGDGP SFGHRVDTDI ADTRGPDVAR MDNGGPRGGG       420
     PSVGDGLHHT PDGHHGGGTP PGGNTATDGP RDSGVPDGRQ PSDSHVGGSH HGNGHVSGDG       480
     TTLHNGDRPI DSRTPFDGHT QVEGHAPVDG HTPDGDRPDG DHTSSPDGGD PSSTSPAPGA       540
     DTPALPERLG NQPDGSWVNV EHGTRYDLSP EMNAAVDRYL GGASVTEGHV TPHVRSIADG       600
     IDGARLQGYP DFVLKGEDSF KRKFAQDLAR YPDLSPDEIL ANVKDSVRYT IEMPSRNYTD       660
     GVLSAVDDLR ARGYENVTFK PTWENPDTYK GVNSTWRDPA TGRVFELQFH TPDSFKAKMD       720
     THGLYEAERV ATDEADRLRA AEAQAEIFRQ VDVPDHAIDR LHELKQTLEA ERAAVDPADH       780
     APPQHPDADG HGHHDGNPAP GPADPGDPAG HGDGAGDAAP DWSAVSGTTD VNSKPALHSG       840
     TATPEQAQRY VAEHHPYVVD VNVDRFQRGV PGSDQNCSRC VRAVDLGFTG TPASALPWPE       900
     GPGWGLSSNT FADYARSLGA DPAAFRQVSS YDDIIGDMTA RGEGARGMVY IGRPGSAHVF       960
     NVVHDQNGVV FLDGQTGGLA LLEKNVNIMY LPIGR                                  995
//

If you have problems or comments...

PBIL Back to PBIL home page