(data stored in SCRATCH zone)

EMBL: AM420293.PE579

AM420293.PE579       Location/Qualifiers
FT   CDS             complement(650507..650812)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99934"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7B0"
FT                   /protein_id="CAL99934.1"
FT                   /translation="MTMDRRSFDTGVSQSVQGDLQGIIGRLESVIGQRDQAVAAAMADF
FT                   QADGVSDDYHHVEQRWKSAATEVRQIINLVKQTMTQNDDSANTALSRARSAVQGIG"
     MTMDRRSFDT GVSQSVQGDL QGIIGRLESV IGQRDQAVAA AMADFQADGV SDDYHHVEQR        60
     WKSAATEVRQ IINLVKQTMT QNDDSANTAL SRARSAVQGI G                           101
//

If you have problems or comments...

PBIL Back to PBIL home page