(data stored in SCRATCH zone)

EMBL: AM420293.PE583

AM420293.PE583       Location/Qualifiers
FT   CDS             complement(653241..653462)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0593"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99938"
FT                   /db_xref="GOA:A4F7B4"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7B4"
FT                   /protein_id="CAL99938.1"
FT                   /translation="MASSSSRSAVLPVSMGMFGLGLIAVVAVFALYATGSTDLPLWLNL
FT                   ATLLAPAGLVIGVVAIVVRSRRATRGTR"
     MASSSSRSAV LPVSMGMFGL GLIAVVAVFA LYATGSTDLP LWLNLATLLA PAGLVIGVVA        60
     IVVRSRRATR GTR                                                           73
//

If you have problems or comments...

PBIL Back to PBIL home page