(data stored in ACNUC1104 zone)

EMBL: AM420293.PE584

AM420293.PE584       Location/Qualifiers
FT   CDS             653734..654126
FT                   /transl_table=11
FT                   /locus_tag="SACE_0594"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /function="Cold shock proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0594"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99939"
FT                   /db_xref="GOA:A4F7B5"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7B5"
FT                   /protein_id="CAL99939.1"
FT                   /translation="MPTGRVKWFDAEKGFGFVTQDGGEDVYVRASALPSGVESLKTGQR
FT                   VDFDMAQGRRGPQALKVQLLDPPPSVVEARRRPADELHGMVDDMIKLLELKVLPDLRRG
FT                   RYPDRKVSKRIGEVVRAVARELDPGA"
     MPTGRVKWFD AEKGFGFVTQ DGGEDVYVRA SALPSGVESL KTGQRVDFDM AQGRRGPQAL        60
     KVQLLDPPPS VVEARRRPAD ELHGMVDDMI KLLELKVLPD LRRGRYPDRK VSKRIGEVVR       120
     AVARELDPGA                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page