(data stored in ACNUC1104 zone)

EMBL: AM420293.PE589

AM420293.PE589       Location/Qualifiers
FT   CDS             658754..661708
FT                   /transl_table=11
FT                   /locus_tag="SACE_0599"
FT                   /product="putative heat shock protein, HSP90-family"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0599"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99944"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7C0"
FT                   /protein_id="CAL99944.1"
FT                   /translation="MNGTDVFGTAELRQAVLQSWRSSPTRFREDANAEEDLRLGGYRDR
FT                   LLVELAQNAADAAGSKGVLRVRLADGELRVANTGEPLTAEGVAGLASLRASAKREGSTV
FT                   GRYGVGFAAVLAVSEEPRVVSSSGSVTFSAERTRQEAERLPGPAEELAARAGEVPVLRL
FT                   VWPLEDVPPEGFATEVRLPLRSGVDADALLESFAEQASGLLLALPALTEIHIGEQTWYR
FT                   TDEGRDRVVVHGPRGAERWQVQRGAGQVGEAALAGLGVEARRDTGWWVCWAAPLDADGV
FT                   PAPLERDVLHAPTPTDERLSLPARLLASVPMEADRRRAAASPATDQVLVRAAECYPELV
FT                   ARIAPEHRPALVPLPGFPMSDVDDKLRQAVTDRLRVAEWLPRAGGGLVAPLEARVLDQA
FT                   LPELAELLRDAVPGLLTAEMAELRHRAALSALEVRRLGPAEIVQAVTGLERPAPWWNRL
FT                   YEALRPIASADSQAREEFAALPVPLADGRTVTGVRDVLLGSDADPAGVLSTLDISGLRI
FT                   VHPEAAHPMLEELGARPAGPDELLDSPSLAEAVRGSVTDAHTSVDARALADAVLGLVER
FT                   SRPRDWLGALALPDSEGGFRRADELLLPEAALREVLAPDAPLGVVDAEFAARWPAGLLR
FT                   SIGVIDSFVVHVEEEPAEPDTGFADAERWWLDNEAEQHDQWPPDRFVGIRDLDLVAEDA
FT                   WPAALRLLAEDPDTLRALRDPAGYPAWWIARHASLAGLPPRHWRLPAAEEIAGLYDPVP
FT                   DVGLDTEQLRLAGVRDAMRVDDAADAADLIERLGDVDRALRAGTALRAHRALADAVACG
FT                   VIDASEIEPPHSVRSLSGAVVSAERAAVLDEPWMLGVLDAPLLVSGGSPDQFDAEALAE
FT                   LFDLPLASEENAMQVQGPGRAQRWGDVARVATSCELLGIAVPTGEVTLHDTLVVQAATT
FT                   GHRVHWWVDTGGTVHAERTPDGLGRALAWAAGSWGERFALGALLADPEATTLLR"
     MNGTDVFGTA ELRQAVLQSW RSSPTRFRED ANAEEDLRLG GYRDRLLVEL AQNAADAAGS        60
     KGVLRVRLAD GELRVANTGE PLTAEGVAGL ASLRASAKRE GSTVGRYGVG FAAVLAVSEE       120
     PRVVSSSGSV TFSAERTRQE AERLPGPAEE LAARAGEVPV LRLVWPLEDV PPEGFATEVR       180
     LPLRSGVDAD ALLESFAEQA SGLLLALPAL TEIHIGEQTW YRTDEGRDRV VVHGPRGAER       240
     WQVQRGAGQV GEAALAGLGV EARRDTGWWV CWAAPLDADG VPAPLERDVL HAPTPTDERL       300
     SLPARLLASV PMEADRRRAA ASPATDQVLV RAAECYPELV ARIAPEHRPA LVPLPGFPMS       360
     DVDDKLRQAV TDRLRVAEWL PRAGGGLVAP LEARVLDQAL PELAELLRDA VPGLLTAEMA       420
     ELRHRAALSA LEVRRLGPAE IVQAVTGLER PAPWWNRLYE ALRPIASADS QAREEFAALP       480
     VPLADGRTVT GVRDVLLGSD ADPAGVLSTL DISGLRIVHP EAAHPMLEEL GARPAGPDEL       540
     LDSPSLAEAV RGSVTDAHTS VDARALADAV LGLVERSRPR DWLGALALPD SEGGFRRADE       600
     LLLPEAALRE VLAPDAPLGV VDAEFAARWP AGLLRSIGVI DSFVVHVEEE PAEPDTGFAD       660
     AERWWLDNEA EQHDQWPPDR FVGIRDLDLV AEDAWPAALR LLAEDPDTLR ALRDPAGYPA       720
     WWIARHASLA GLPPRHWRLP AAEEIAGLYD PVPDVGLDTE QLRLAGVRDA MRVDDAADAA       780
     DLIERLGDVD RALRAGTALR AHRALADAVA CGVIDASEIE PPHSVRSLSG AVVSAERAAV       840
     LDEPWMLGVL DAPLLVSGGS PDQFDAEALA ELFDLPLASE ENAMQVQGPG RAQRWGDVAR       900
     VATSCELLGI AVPTGEVTLH DTLVVQAATT GHRVHWWVDT GGTVHAERTP DGLGRALAWA       960
     AGSWGERFAL GALLADPEAT TLLR                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page