(data stored in SCRATCH zone)

EMBL: AM420293.PE591

AM420293.PE591       Location/Qualifiers
FT   CDS             664266..666092
FT                   /transl_table=11
FT                   /locus_tag="SACE_0601"
FT                   /product="multidrug ABC transporter, ATP-binding protein"
FT                   /function="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0601"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99946"
FT                   /db_xref="GOA:A4F7C2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7C2"
FT                   /protein_id="CAL99946.1"
FT                   /translation="MEPDAASRPTSSLRTLISRLAPFRGALTVVLLLELGTRAAALIQP
FT                   LAARAVVDGVAARADLMWPIAVLGAVAIIGLCLNYAGFYQRGKLSERFVLGLRKAMAGR
FT                   IVGAPVSYVESRSTADLVSRVGADSTLIQQTTVKALVDLVVVPLTVVAGIVLMLTIDVF
FT                   LALVVIVLLSVAGLAEAGVFRRVVVDTETAQEHVAGLTGVVQRVLLAFRTVKASRSERR
FT                   EAESFDRNADSAYRASVKAVRTGALADTVAYAAVDFTFLVTLAVGVVRVSTGSVGVGDL
FT                   VAILLYVVYIQEPVEALTNSAGKLSEGLAALRRITELLDAPQETDTAAAPARTEVPAVS
FT                   NGSKPPASRRSVRFDQVWFGYGDQPVLRDVSIEAVPGLTVLVGSSGAGKTTLLSLAERF
FT                   VEPERGAVLLDGADVRDLPLAELRGRVAYVQQEAPLLGATIGEAATYGVDDVDEERLRR
FT                   ILESVGLRTWIEGLPLGLDTEVGERGVQISGGQRQRLAVARALARDSEVLLLDEATSQL
FT                   DPLNEQNLVRSLTRDFRDRVVIAVTHRMPMAYQADQVIMLRHGSVHARGTHDDLLSDPH
FT                   YRQLIASPSAGSPELAEQLTASGEDGRGEPGA"
     MEPDAASRPT SSLRTLISRL APFRGALTVV LLLELGTRAA ALIQPLAARA VVDGVAARAD        60
     LMWPIAVLGA VAIIGLCLNY AGFYQRGKLS ERFVLGLRKA MAGRIVGAPV SYVESRSTAD       120
     LVSRVGADST LIQQTTVKAL VDLVVVPLTV VAGIVLMLTI DVFLALVVIV LLSVAGLAEA       180
     GVFRRVVVDT ETAQEHVAGL TGVVQRVLLA FRTVKASRSE RREAESFDRN ADSAYRASVK       240
     AVRTGALADT VAYAAVDFTF LVTLAVGVVR VSTGSVGVGD LVAILLYVVY IQEPVEALTN       300
     SAGKLSEGLA ALRRITELLD APQETDTAAA PARTEVPAVS NGSKPPASRR SVRFDQVWFG       360
     YGDQPVLRDV SIEAVPGLTV LVGSSGAGKT TLLSLAERFV EPERGAVLLD GADVRDLPLA       420
     ELRGRVAYVQ QEAPLLGATI GEAATYGVDD VDEERLRRIL ESVGLRTWIE GLPLGLDTEV       480
     GERGVQISGG QRQRLAVARA LARDSEVLLL DEATSQLDPL NEQNLVRSLT RDFRDRVVIA       540
     VTHRMPMAYQ ADQVIMLRHG SVHARGTHDD LLSDPHYRQL IASPSAGSPE LAEQLTASGE       600
     DGRGEPGA                                                                608
//

If you have problems or comments...

PBIL Back to PBIL home page