(data stored in ACNUC1104 zone)

EMBL: AM420293.PE592

AM420293.PE592       Location/Qualifiers
FT   CDS             666076..666537
FT                   /transl_table=11
FT                   /locus_tag="SACE_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0602"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99947"
FT                   /db_xref="GOA:A4F7C3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7C3"
FT                   /protein_id="CAL99947.1"
FT                   /translation="MSPVPEDYTWRSPRAGDAGRGESMIRGVAVRDRPTLESTAADFAE
FT                   ALGETDLTSDGFGVFRGEALVGYSLLRSGRDGRWYEVQRCVHGEHRGRGLGTVLLGWGR
FT                   AQAAQRRAVAGTAGELRVWCPDHSAARKSLGELPGRAARVTSEPLLEPR"
     MSPVPEDYTW RSPRAGDAGR GESMIRGVAV RDRPTLESTA ADFAEALGET DLTSDGFGVF        60
     RGEALVGYSL LRSGRDGRWY EVQRCVHGEH RGRGLGTVLL GWGRAQAAQR RAVAGTAGEL       120
     RVWCPDHSAA RKSLGELPGR AARVTSEPLL EPR                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page