(data stored in ACNUC1104 zone)

EMBL: AM420293.PE595

AM420293.PE595       Location/Qualifiers
FT   CDS             670869..671426
FT                   /transl_table=11
FT                   /locus_tag="SACE_0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0605"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99950"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7C6"
FT                   /protein_id="CAL99950.1"
FT                   /translation="MPTRSDAVVVGTTAPVRSADARVVGGCESTAAAVTATLGAAIATL
FT                   PDEAGTSVPVLVLADAYSRWAARRFARRCADPARRLRPSDSTGLETSELLRKFAIASGW
FT                   RGPCYLLAGSDAAEFLETGRAFAATGPVVLCEVAPLDTDALDDPGCTVTAVVLTGADSV
FT                   LDIPQAPPGALLAAAGSAGGRG"
     MPTRSDAVVV GTTAPVRSAD ARVVGGCEST AAAVTATLGA AIATLPDEAG TSVPVLVLAD        60
     AYSRWAARRF ARRCADPARR LRPSDSTGLE TSELLRKFAI ASGWRGPCYL LAGSDAAEFL       120
     ETGRAFAATG PVVLCEVAPL DTDALDDPGC TVTAVVLTGA DSVLDIPQAP PGALLAAAGS       180
     AGGRG                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page