(data stored in ACNUC1104 zone)

EMBL: AM420293.PE598

AM420293.PE598       Location/Qualifiers
FT   CDS             673302..674228
FT                   /transl_table=11
FT                   /locus_tag="SACE_0608"
FT                   /product="hypothetical protein"
FT                   /function="N-Dimethylarginine dimethylaminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0608"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99953"
FT                   /db_xref="GOA:A4F7C9"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7C9"
FT                   /protein_id="CAL99953.1"
FT                   /translation="MTTTSEVQSPRNPSEFEGPAFLLNAPFSFSAEVYGDTDDGRRRPD
FT                   SRRAMAQFLSLYRFLAAESLVYLLPTPRADGLRDLVFTANLGIVLEHLPERDTVVLANS
FT                   GRPRAGARAVAASFFESMGYRVVVPERAFEGEAALKHLHGNVYVGGYGSCSQRESYEWM
FT                   ERTLDMTVVPVAQHGPLLRRLDRALFPITREQTLVCTGVLDQDELRLLEKHTEVVDVSV
FT                   AGAGAGLCGSLRLDNLILNASHIHELAAGSEEYWRELAKNRELEDVATRLGFEIALINL
FT                   SEYRRSGAQLSCMVMHLNRHAYRYSQL"
     MTTTSEVQSP RNPSEFEGPA FLLNAPFSFS AEVYGDTDDG RRRPDSRRAM AQFLSLYRFL        60
     AAESLVYLLP TPRADGLRDL VFTANLGIVL EHLPERDTVV LANSGRPRAG ARAVAASFFE       120
     SMGYRVVVPE RAFEGEAALK HLHGNVYVGG YGSCSQRESY EWMERTLDMT VVPVAQHGPL       180
     LRRLDRALFP ITREQTLVCT GVLDQDELRL LEKHTEVVDV SVAGAGAGLC GSLRLDNLIL       240
     NASHIHELAA GSEEYWRELA KNRELEDVAT RLGFEIALIN LSEYRRSGAQ LSCMVMHLNR       300
     HAYRYSQL                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page