(data stored in ACNUC1104 zone)

EMBL: AM420293.PE606

AM420293.PE606       Location/Qualifiers
FT   CDS             680028..680969
FT                   /transl_table=11
FT                   /locus_tag="SACE_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0616"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99961"
FT                   /db_xref="GOA:A4F7D7"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7D7"
FT                   /protein_id="CAL99961.1"
FT                   /translation="MTLAIGLLAGAVFIALSGPLYLRAVVSPRVRPGVALTVWVASAAV
FT                   VVTGAVTGAVLLVLPHRGAADHLIGMAWTCVNAVHAGGEPVWEHVLRLGAALPVFAATV
FT                   RTLFVAYRLTRRDAGRRRHHLRLLRALSTAEPDSAVLWLEQATPVAYSLGGRRGAIVAT
FT                   TGVSRLGAAERDAILAHERAHLSGNHHRLVLMADVLARALPFVPLFRAAPPMVRVLVEL
FT                   AADAAAATRCGPGPVRSALRAVSGAGVPAGSLAMSREAVELRLRWLGAARGSRRGRTGY
FT                   LAAVFAAAAPAMAAVGVVAGLVLLYCLSDGRL"
     MTLAIGLLAG AVFIALSGPL YLRAVVSPRV RPGVALTVWV ASAAVVVTGA VTGAVLLVLP        60
     HRGAADHLIG MAWTCVNAVH AGGEPVWEHV LRLGAALPVF AATVRTLFVA YRLTRRDAGR       120
     RRHHLRLLRA LSTAEPDSAV LWLEQATPVA YSLGGRRGAI VATTGVSRLG AAERDAILAH       180
     ERAHLSGNHH RLVLMADVLA RALPFVPLFR AAPPMVRVLV ELAADAAAAT RCGPGPVRSA       240
     LRAVSGAGVP AGSLAMSREA VELRLRWLGA ARGSRRGRTG YLAAVFAAAA PAMAAVGVVA       300
     GLVLLYCLSD GRL                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page