(data stored in ACNUC1104 zone)

EMBL: AM420293.PE607

AM420293.PE607       Location/Qualifiers
FT   CDS             681012..681710
FT                   /transl_table=11
FT                   /locus_tag="SACE_0617"
FT                   /product="DsbA-like thioredoxin domain protein"
FT                   /function="Protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0617"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99962"
FT                   /db_xref="GOA:A4F7D8"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7D8"
FT                   /protein_id="CAL99962.1"
FT                   /translation="MGKAKVRRLNVLAGVLAAAVVFLLGYVLATQNRGDAPPAPEPAPQ
FT                   AQQNPLESLARRDPGDPLAKGRPDAPVVLVNYTDFRCPFCAKFGRDIEPELQRRYVDTG
FT                   VLRIEWRDFPIFGEESLSAAEAGRAAARQGRFWEFHDAVFAQAPPTGHPPMPRERLVEL
FT                   ARQAGVPDIQRFEADMGDPGVYAGIQADAMEGAQLGVSSTPTFVINGQPVFGAQPLEVF
FT                   TEVIEQARAR"
     MGKAKVRRLN VLAGVLAAAV VFLLGYVLAT QNRGDAPPAP EPAPQAQQNP LESLARRDPG        60
     DPLAKGRPDA PVVLVNYTDF RCPFCAKFGR DIEPELQRRY VDTGVLRIEW RDFPIFGEES       120
     LSAAEAGRAA ARQGRFWEFH DAVFAQAPPT GHPPMPRERL VELARQAGVP DIQRFEADMG       180
     DPGVYAGIQA DAMEGAQLGV SSTPTFVING QPVFGAQPLE VFTEVIEQAR AR               232
//

If you have problems or comments...

PBIL Back to PBIL home page