(data stored in ACNUC1104 zone)

EMBL: AM420293.PE608

AM420293.PE608       Location/Qualifiers
FT   CDS             681707..682567
FT                   /transl_table=11
FT                   /locus_tag="SACE_0618"
FT                   /product="integral membrane cytochrome biogenesis protein"
FT                   /function="Cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0618"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99963"
FT                   /db_xref="GOA:A4F7D9"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7D9"
FT                   /protein_id="CAL99963.1"
FT                   /translation="MTEIGLVGAFLGGLLSLLSPCSALLLPSFFAYAFNGIGRLVARTS
FT                   VFYAGLCVTLVPLGAAAGLFGALLTSYRDTVTLAGGLVLVGLGLLQISGRGFGISAAQQ
FT                   LTGRIRVSSNLSVFALGAVYGLAGFCAGPLLGSVLTVSATGGDPLYGAVLLAVFALGMA
FT                   FPLFVLAVLWDRFDIRNRKWLRGREIGVGRLRVHTANLVSGLVFVAIGVLFVVTDGTAN
FT                   LGGLADVDGQFAVQVWLRRAVAGVTDAQVLLVVAVVALVAVLWRIRHVERKADQDAERE
FT                   PADRE"
     MTEIGLVGAF LGGLLSLLSP CSALLLPSFF AYAFNGIGRL VARTSVFYAG LCVTLVPLGA        60
     AAGLFGALLT SYRDTVTLAG GLVLVGLGLL QISGRGFGIS AAQQLTGRIR VSSNLSVFAL       120
     GAVYGLAGFC AGPLLGSVLT VSATGGDPLY GAVLLAVFAL GMAFPLFVLA VLWDRFDIRN       180
     RKWLRGREIG VGRLRVHTAN LVSGLVFVAI GVLFVVTDGT ANLGGLADVD GQFAVQVWLR       240
     RAVAGVTDAQ VLLVVAVVAL VAVLWRIRHV ERKADQDAER EPADRE                      286
//

If you have problems or comments...

PBIL Back to PBIL home page