(data stored in ACNUC1104 zone)

EMBL: AM420293.PE610

AM420293.PE610       Location/Qualifiers
FT   CDS             683738..684682
FT                   /transl_table=11
FT                   /locus_tag="SACE_0620"
FT                   /product="putative iron ABC transporter binding protein"
FT                   /function="ABC-type Fe3+-hydroxamate transport system"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0620"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99965"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7E1"
FT                   /protein_id="CAL99965.1"
FT                   /translation="MRRLLVVLATTLLLAGCGTAASTGPAWEGMRVENCGRTQVIAEPP
FT                   RRVVSLNQHATEILLALGLGDRLVGTAYPDDRTPPASVAADYARVPLLAVEYPSAERIL
FT                   EAEPDLVVGGYSSAFDEGEGRGREALESKGIATLLLSESCATGPTGMPALLADIDMFGS
FT                   VLGLRERASVLAADIEGRVRAVEQRLAGVPPVDVFVYDSGEQAAFTLGGHGVGNDALTR
FT                   AGARNVFADVPEGFADVSWEQVASRAPRAIVLVDYLAKPVHDKRAYLEGHPLASGTPAV
FT                   RADRYSTVPLVELTEGIRFPDAVERLARDLHGA"
     MRRLLVVLAT TLLLAGCGTA ASTGPAWEGM RVENCGRTQV IAEPPRRVVS LNQHATEILL        60
     ALGLGDRLVG TAYPDDRTPP ASVAADYARV PLLAVEYPSA ERILEAEPDL VVGGYSSAFD       120
     EGEGRGREAL ESKGIATLLL SESCATGPTG MPALLADIDM FGSVLGLRER ASVLAADIEG       180
     RVRAVEQRLA GVPPVDVFVY DSGEQAAFTL GGHGVGNDAL TRAGARNVFA DVPEGFADVS       240
     WEQVASRAPR AIVLVDYLAK PVHDKRAYLE GHPLASGTPA VRADRYSTVP LVELTEGIRF       300
     PDAVERLARD LHGA                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page