(data stored in ACNUC1104 zone)

EMBL: AM420293.PE617

AM420293.PE617       Location/Qualifiers
FT   CDS             691520..692206
FT                   /transl_table=11
FT                   /locus_tag="SACE_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0627"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99972"
FT                   /db_xref="GOA:A4F7E8"
FT                   /db_xref="InterPro:IPR024244"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7E8"
FT                   /protein_id="CAL99972.1"
FT                   /translation="MKSTTWELRARSGRAVLVNGAEREVDPARLPLPEALVDALHEWAH
FT                   VVDAISEAPAGESAEDAEAQLAAVSGEVATQVSQRGRQLALRLAVETGGEIGYADPVTG
FT                   EVDRVGRRRTSGQAAGRYTGWYARGGRPGPVPPTPWATGLTITAIIAAIVVVTLVVVTQ
FT                   GLAEVSPALAIGVNVVVAAGFAPSIWLGRRIPVWRWVAFGTAAGVVLAWIALLLSALGP
FT                   STPGVH"
     MKSTTWELRA RSGRAVLVNG AEREVDPARL PLPEALVDAL HEWAHVVDAI SEAPAGESAE        60
     DAEAQLAAVS GEVATQVSQR GRQLALRLAV ETGGEIGYAD PVTGEVDRVG RRRTSGQAAG       120
     RYTGWYARGG RPGPVPPTPW ATGLTITAII AAIVVVTLVV VTQGLAEVSP ALAIGVNVVV       180
     AAGFAPSIWL GRRIPVWRWV AFGTAAGVVL AWIALLLSAL GPSTPGVH                    228
//

If you have problems or comments...

PBIL Back to PBIL home page