(data stored in ACNUC1104 zone)

EMBL: AM420293.PE618

AM420293.PE618       Location/Qualifiers
FT   CDS             692521..692748
FT                   /transl_table=11
FT                   /locus_tag="SACE_0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0628"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99973"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7E9"
FT                   /protein_id="CAL99973.1"
FT                   /translation="MPTSIPTRTISRLPADAPEIRVRAATLNAALRVTADDFAWATAEG
FT                   VSADAVDRHRKRMAEALRTTASSAVHLAEL"
     MPTSIPTRTI SRLPADAPEI RVRAATLNAA LRVTADDFAW ATAEGVSADA VDRHRKRMAE        60
     ALRTTASSAV HLAEL                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page