(data stored in ACNUC1104 zone)

EMBL: AM420293.PE62

AM420293.PE62        Location/Qualifiers
FT   CDS             85308..86507
FT                   /transl_table=11
FT                   /locus_tag="SACE_0064"
FT                   /product="amino acid aldolase or racemase-like"
FT                   /function="predicted amino acid aldolase or racemase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99417"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5U3"
FT                   /protein_id="CAL99417.1"
FT                   /translation="MLKALPESRRLDTATIELDPPFAVADLDAFHRNAADLVRRAAGRP
FT                   VRVATKSVRCRELLRRTLTTPGFAGLMCYSLAEALWLHGDGLSEDVLVAYPTADRGALR
FT                   QLVARPTAAAAITIMVDSVEHLDLVDAAVGTRRPEIRVCLDIDASWRPLPAMHIGTRRS
FT                   PVHTAADARRLAEAVVRRAGFRLAGLMAYEGQIAGLGDAPPGSPLRGAGVRWMQRRSAA
FT                   ELAGRRAEIVTAIRELAELEFVNGGGTGSIETTTAESAVTEVAAGSGLVGPTLFDAYRS
FT                   FRPEPALLFALPVVHRPGGRVATVFGGGYIASGPVGADRAPTPYLPTGLKLTAVEGAGE
FT                   VQTPVAGHAARRLRLGDRVWFRHAKAGELAERFNEYHLVDGDRVADSVPTYRGEGRSFG
FT                   "
     MLKALPESRR LDTATIELDP PFAVADLDAF HRNAADLVRR AAGRPVRVAT KSVRCRELLR        60
     RTLTTPGFAG LMCYSLAEAL WLHGDGLSED VLVAYPTADR GALRQLVARP TAAAAITIMV       120
     DSVEHLDLVD AAVGTRRPEI RVCLDIDASW RPLPAMHIGT RRSPVHTAAD ARRLAEAVVR       180
     RAGFRLAGLM AYEGQIAGLG DAPPGSPLRG AGVRWMQRRS AAELAGRRAE IVTAIRELAE       240
     LEFVNGGGTG SIETTTAESA VTEVAAGSGL VGPTLFDAYR SFRPEPALLF ALPVVHRPGG       300
     RVATVFGGGY IASGPVGADR APTPYLPTGL KLTAVEGAGE VQTPVAGHAA RRLRLGDRVW       360
     FRHAKAGELA ERFNEYHLVD GDRVADSVPT YRGEGRSFG                              399
//

If you have problems or comments...

PBIL Back to PBIL home page