(data stored in SCRATCH zone)

EMBL: AM420293.PE64

AM420293.PE64        Location/Qualifiers
FT   CDS             87704..91024
FT                   /transl_table=11
FT                   /locus_tag="SACE_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99419"
FT                   /db_xref="InterPro:IPR007817"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5U5"
FT                   /protein_id="CAL99419.1"
FT                   /translation="MDGWRRRDLWSPLAVAEANAMLRDGAYGLRVEPAPWRLTGPGAGV
FT                   GLPLGEAPTWADLYRALVRLRRTRRTHDPAWLHRLTRTLSGEVPAAGATRWVAVPPDRL
FT                   ERLTADCGTDLRHFLAPLVASDGSMLFPASGGGLERPDLVVDDNGGVITVRGEAGPPVR
FT                   LRATDLGGARSQLSNWSALAAAVESDPVLRMHCAAQAVPAALADADSVLLLQGIEPSPR
FT                   HPGHPGGTVVAGLPALLRPTAGGRAGLLRLVIENRFEHREDELGYFLDHLVRPLLRTFR
FT                   LALDDHRLALLSLNPDGAGFELSTELQLTGRAVVTDPGEVRPEPTGAEVTAAADGLTRT
FT                   LDELTAGFAAIGFAGGGHPHAAVRAAVDQVTAEELRFLRPRTAELLAGDHGLRGFAHSV
FT                   PEDQDRVLKEVLHAVEERTRKRRWKRDLPQPVVVIDLDLCGILPMRRTLDAARAVSGPR
FT                   PGAPEGILELARPGSLPVLPNFSESAWDNFVDLSGLGRKYPTVDWRQVHAEFFRAFSRP
FT                   WERLRTDTVNPGLARFVWDVHDGGGRVVFCTGRRERVRAHTEAVLAAAGVPDAALLCMP
FT                   DDRTRPISELKVEKLRELGDIDVVAVFDDLQRNRVALTEEFTGARAVAVEIPGMATERR
FT                   PGQPLGDQAPVISTFETVPRRAAPSLSNTHSLEELQIGAMRRNRISRDWAVHLSERETL
FT                   SLVGSVLADADRSAARTARGARVKFGLDQGEPGFEQVIRALHHVFTRKQFLKGSRSNYR
FT                   WEDMLRDAGPFVSRDEPLEIVLLGFPVKQCLNRLKAFGPLPDLAELGGLARLRELRQAV
FT                   SAVYPPGVHFNILTDGRHFRPRPAAITGAYSRKLREYVRLVGIDDCTTVEEIDTVARQR
FT                   LGPDLPARRAARLARYRAEIYQALQGLDITANPLRTLDGVDHRVSMMDGALGESMRLFR
FT                   EMLMSVVYSVPVTVPAGVDRLTWSTLVYADIYNTADPAVPDEVRRGRAAVLSRAWHTVV
FT                   RYLATLRVDEELGYEELFPHRVRLTVSAARPGRCGFTYLGGSGLLPWQGTGVLDPRGHV
FT                   AVDFAIAVLDQGFVPVYSPLLGPRQPLMMVPAQHTRPSASGGLRLDDALAERVRLRRK"
     MDGWRRRDLW SPLAVAEANA MLRDGAYGLR VEPAPWRLTG PGAGVGLPLG EAPTWADLYR        60
     ALVRLRRTRR THDPAWLHRL TRTLSGEVPA AGATRWVAVP PDRLERLTAD CGTDLRHFLA       120
     PLVASDGSML FPASGGGLER PDLVVDDNGG VITVRGEAGP PVRLRATDLG GARSQLSNWS       180
     ALAAAVESDP VLRMHCAAQA VPAALADADS VLLLQGIEPS PRHPGHPGGT VVAGLPALLR       240
     PTAGGRAGLL RLVIENRFEH REDELGYFLD HLVRPLLRTF RLALDDHRLA LLSLNPDGAG       300
     FELSTELQLT GRAVVTDPGE VRPEPTGAEV TAAADGLTRT LDELTAGFAA IGFAGGGHPH       360
     AAVRAAVDQV TAEELRFLRP RTAELLAGDH GLRGFAHSVP EDQDRVLKEV LHAVEERTRK       420
     RRWKRDLPQP VVVIDLDLCG ILPMRRTLDA ARAVSGPRPG APEGILELAR PGSLPVLPNF       480
     SESAWDNFVD LSGLGRKYPT VDWRQVHAEF FRAFSRPWER LRTDTVNPGL ARFVWDVHDG       540
     GGRVVFCTGR RERVRAHTEA VLAAAGVPDA ALLCMPDDRT RPISELKVEK LRELGDIDVV       600
     AVFDDLQRNR VALTEEFTGA RAVAVEIPGM ATERRPGQPL GDQAPVISTF ETVPRRAAPS       660
     LSNTHSLEEL QIGAMRRNRI SRDWAVHLSE RETLSLVGSV LADADRSAAR TARGARVKFG       720
     LDQGEPGFEQ VIRALHHVFT RKQFLKGSRS NYRWEDMLRD AGPFVSRDEP LEIVLLGFPV       780
     KQCLNRLKAF GPLPDLAELG GLARLRELRQ AVSAVYPPGV HFNILTDGRH FRPRPAAITG       840
     AYSRKLREYV RLVGIDDCTT VEEIDTVARQ RLGPDLPARR AARLARYRAE IYQALQGLDI       900
     TANPLRTLDG VDHRVSMMDG ALGESMRLFR EMLMSVVYSV PVTVPAGVDR LTWSTLVYAD       960
     IYNTADPAVP DEVRRGRAAV LSRAWHTVVR YLATLRVDEE LGYEELFPHR VRLTVSAARP      1020
     GRCGFTYLGG SGLLPWQGTG VLDPRGHVAV DFAIAVLDQG FVPVYSPLLG PRQPLMMVPA      1080
     QHTRPSASGG LRLDDALAER VRLRRK                                           1106
//

If you have problems or comments...

PBIL Back to PBIL home page