(data stored in ACNUC1104 zone)

EMBL: AM420293.PE640

AM420293.PE640       Location/Qualifiers
FT   CDS             complement(714930..716198)
FT                   /transl_table=11
FT                   /gene="cypA"
FT                   /locus_tag="SACE_0651"
FT                   /product="cytochrome P450-like enzyme"
FT                   /function="Cytochrome P450"
FT                   /EC_number="1.14.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0651"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99995"
FT                   /db_xref="GOA:A4F7H1"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7H1"
FT                   /protein_id="CAL99995.1"
FT                   /translation="MQPDQSPTPRPESRHSPAAACPHAAVHREERPGGLVTWQISAFSE
FT                   ARAALGDSRFSKDPRRLGEALRAGGRSMFAEYGDNLLDNLLNSDPPDHTRLRRLVGKAF
FT                   SPATIERLGPTTQRLADELVASMLPAGRADLLAQFAYPFAFGVIARVLGLPPDSYRIFQ
FT                   RWTESMTAPREQGTDRMVAARHLCEHVTELVRRSREWLASAPAETLLDELVSARDDGDR
FT                   LSENELVATVLLLIIAGHETTVNLIGNGVHALLQHPGQLALLRDHPDLIDGAVEELLRF
FT                   QPPISKTTLRVTTTDVEVAGTEIPAGSIVNVLVPAANRDQRQFPDADRLDITRPPSAHM
FT                   SFGHGIHYCIGAPLARMEGRIAIGALLRGLPGLRLAEPAAEIPWRASNILRGLQRLPVR
FT                   FDSAGADDEVRDRRHAGAARVHA"
     MQPDQSPTPR PESRHSPAAA CPHAAVHREE RPGGLVTWQI SAFSEARAAL GDSRFSKDPR        60
     RLGEALRAGG RSMFAEYGDN LLDNLLNSDP PDHTRLRRLV GKAFSPATIE RLGPTTQRLA       120
     DELVASMLPA GRADLLAQFA YPFAFGVIAR VLGLPPDSYR IFQRWTESMT APREQGTDRM       180
     VAARHLCEHV TELVRRSREW LASAPAETLL DELVSARDDG DRLSENELVA TVLLLIIAGH       240
     ETTVNLIGNG VHALLQHPGQ LALLRDHPDL IDGAVEELLR FQPPISKTTL RVTTTDVEVA       300
     GTEIPAGSIV NVLVPAANRD QRQFPDADRL DITRPPSAHM SFGHGIHYCI GAPLARMEGR       360
     IAIGALLRGL PGLRLAEPAA EIPWRASNIL RGLQRLPVRF DSAGADDEVR DRRHAGAARV       420
     HA                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page