(data stored in SCRATCH zone)

EMBL: AM420293.PE65

AM420293.PE65        Location/Qualifiers
FT   CDS             complement(91437..91775)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99420"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5U6"
FT                   /protein_id="CAL99420.1"
FT                   /translation="MDEILGQVLRNAVWERLDVLTELANRADAPSLLAVARSELPRLTE
FT                   GWRTLLSAHDADEKGNCPECSSRWRPCKAPCTVWRSAYEHLVSGALAPRPARHLRPAHA
FT                   LREVAPVP"
     MDEILGQVLR NAVWERLDVL TELANRADAP SLLAVARSEL PRLTEGWRTL LSAHDADEKG        60
     NCPECSSRWR PCKAPCTVWR SAYEHLVSGA LAPRPARHLR PAHALREVAP VP               112
//

If you have problems or comments...

PBIL Back to PBIL home page