(data stored in ACNUC1104 zone)

EMBL: AM420293.PE652

AM420293.PE652       Location/Qualifiers
FT   CDS             730099..730806
FT                   /transl_table=11
FT                   /locus_tag="SACE_0663"
FT                   /product="protein of unknown function DUF81"
FT                   /function="predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0663"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00007"
FT                   /db_xref="GOA:A4F7I3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7I3"
FT                   /protein_id="CAM00007.1"
FT                   /translation="MSIGFLVLVAVAVAAAAFVQGATGVGFALIVAPVVGLVEPSLLPV
FT                   LLLVLMIPLNLYVAGRERGSLDRTGAGWITAGRFAGTFGGLWVLAAIPLAQLNLLVGGS
FT                   TVLAAVVTLLAPSFSPGRAAFLTAGAVTGVTETATGVGGPPLALVYQHSPAPVLRSTVA
FT                   VCFLAGELISLVVLLATERIRAEQLWLALLLLPAVVLGALLSRFVHHRLDGRLMRLLVQ
FT                   VFAIVSGVVLLFA"
     MSIGFLVLVA VAVAAAAFVQ GATGVGFALI VAPVVGLVEP SLLPVLLLVL MIPLNLYVAG        60
     RERGSLDRTG AGWITAGRFA GTFGGLWVLA AIPLAQLNLL VGGSTVLAAV VTLLAPSFSP       120
     GRAAFLTAGA VTGVTETATG VGGPPLALVY QHSPAPVLRS TVAVCFLAGE LISLVVLLAT       180
     ERIRAEQLWL ALLLLPAVVL GALLSRFVHH RLDGRLMRLL VQVFAIVSGV VLLFA            235
//

If you have problems or comments...

PBIL Back to PBIL home page