(data stored in SCRATCH zone)

EMBL: AM420293.PE654

AM420293.PE654       Location/Qualifiers
FT   CDS             732175..732687
FT                   /transl_table=11
FT                   /locus_tag="SACE_0665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0665"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00009"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7I5"
FT                   /protein_id="CAM00009.1"
FT                   /translation="MTTSSNTPADERDDILATLREQRGFLLITVRGIGDEQAARRTTAS
FT                   ELTLGGIVKHLTRVERYWMQVMTRQEPEIVMDPDQYRMVEGETLAGIVDDYAAAARETE
FT                   QALMATPDLSRQIQLPPAPWAPDPVFWSPRRIMLHLIRETAHHSGHADIIREEMDGAIT
FT                   TTQMASV"
     MTTSSNTPAD ERDDILATLR EQRGFLLITV RGIGDEQAAR RTTASELTLG GIVKHLTRVE        60
     RYWMQVMTRQ EPEIVMDPDQ YRMVEGETLA GIVDDYAAAA RETEQALMAT PDLSRQIQLP       120
     PAPWAPDPVF WSPRRIMLHL IRETAHHSGH ADIIREEMDG AITTTQMASV                  170
//

If you have problems or comments...

PBIL Back to PBIL home page