(data stored in SCRATCH zone)

EMBL: AM420293.PE655

AM420293.PE655       Location/Qualifiers
FT   CDS             complement(732733..733122)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0666"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0666"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00010"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7I6"
FT                   /protein_id="CAM00010.1"
FT                   /translation="MSEQVPASVRYKELAAAATTAAQRMRRHEQEKAAELEESVTRGNS
FT                   RKKEADQQREQVEKDVRIRWNLALEALWDERWLKVSSLPEPDLSAPPATPEESRRTVQD
FT                   AFLELHDALDKPRWSAGSLLRRKSG"
     MSEQVPASVR YKELAAAATT AAQRMRRHEQ EKAAELEESV TRGNSRKKEA DQQREQVEKD        60
     VRIRWNLALE ALWDERWLKV SSLPEPDLSA PPATPEESRR TVQDAFLELH DALDKPRWSA       120
     GSLLRRKSG                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page