(data stored in ACNUC1104 zone)

EMBL: AM420293.PE659

AM420293.PE659       Location/Qualifiers
FT   CDS             complement(736954..737781)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0670"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00014"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7J0"
FT                   /protein_id="CAM00014.1"
FT                   /translation="MRPAMSENTELELLITVVAGAEDERAARDACRGLVRRLDGRIVES
FT                   GDCSDEEPGCWSVTISCTGAASGTGPGALSRAVRTFLRELGPDYGRHRVSCEPPTAWTV
FT                   VDNPELVGDLVAGGERMLVEAWTGGSAAFDSFDPLDDPDEPMPEPDPGPSELDEHGRRR
FT                   PRLALLVDVVTERRAGAEWPARALASRLSRNAVVVDWAERPPMVRIELDLGPAVGEPPE
FT                   IVTNAIAQLGGSGWSRLRVDGPRAMARWSAAPTPPSGIAAIELSAAADAANAD"
     MRPAMSENTE LELLITVVAG AEDERAARDA CRGLVRRLDG RIVESGDCSD EEPGCWSVTI        60
     SCTGAASGTG PGALSRAVRT FLRELGPDYG RHRVSCEPPT AWTVVDNPEL VGDLVAGGER       120
     MLVEAWTGGS AAFDSFDPLD DPDEPMPEPD PGPSELDEHG RRRPRLALLV DVVTERRAGA       180
     EWPARALASR LSRNAVVVDW AERPPMVRIE LDLGPAVGEP PEIVTNAIAQ LGGSGWSRLR       240
     VDGPRAMARW SAAPTPPSGI AAIELSAAAD AANAD                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page