(data stored in ACNUC1104 zone)

EMBL: AM420293.PE660

AM420293.PE660       Location/Qualifiers
FT   CDS             complement(738492..738884)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0672"
FT                   /product="conserved protein (PRC-barrel domain)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0672"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00015"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7J1"
FT                   /protein_id="CAM00015.1"
FT                   /translation="MDVERAQDLIGTAVYDRSGVKIGRVGNVYVHDSTHQPEWVTVRCG
FT                   FLGTRETFVPLNGASTQEDRIDVSVSKDMVKFAPRVAAEHGHLSDAEGRDLYSHYGISE
FT                   LPGVETTGTPGAGQTGTTGRHRRHDG"
     MDVERAQDLI GTAVYDRSGV KIGRVGNVYV HDSTHQPEWV TVRCGFLGTR ETFVPLNGAS        60
     TQEDRIDVSV SKDMVKFAPR VAAEHGHLSD AEGRDLYSHY GISELPGVET TGTPGAGQTG       120
     TTGRHRRHDG                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page