(data stored in ACNUC1104 zone)

EMBL: AM420293.PE667

AM420293.PE667       Location/Qualifiers
FT   CDS             747416..747760
FT                   /transl_table=11
FT                   /locus_tag="SACE_0680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0680"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00022"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7J8"
FT                   /protein_id="CAM00022.1"
FT                   /translation="MIALLLASVSMPLPLTVRMSLPAPMRLAVRMPLAALMSLLVGMPL
FT                   AAPKPLAALIPMPPPLSLAPPMSLAPPRLLAAVSWPAPTPMPRPMHAVASSSAMLQRPT
FT                   SADAMPWRPC"
     MIALLLASVS MPLPLTVRMS LPAPMRLAVR MPLAALMSLL VGMPLAAPKP LAALIPMPPP        60
     LSLAPPMSLA PPRLLAAVSW PAPTPMPRPM HAVASSSAML QRPTSADAMP WRPC             114
//

If you have problems or comments...

PBIL Back to PBIL home page