(data stored in SCRATCH zone)

EMBL: AM420293.PE671

AM420293.PE671       Location/Qualifiers
FT   CDS             complement(751847..752866)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0684"
FT                   /product="probable transcriptional regulator, AraC family"
FT                   /function="AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0684"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00026"
FT                   /db_xref="GOA:A4F7K2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7K2"
FT                   /protein_id="CAM00026.1"
FT                   /translation="MDPLADLLHGVRAQGAQFCQSILSPPWSLRFESTASLELHTMLHE
FT                   DAWIVPDDGPVLRLRPGDIAVVRGPGRYVIADEPSTPPGLLVRDDRCFSIADGSDVGEA
FT                   LALGPRTFGSSADGSATLVSGTYQLPDSLGERLLCALPPVLVVPAVDDSCLELLELVTA
FT                   ELVRDTPGQQIALDRMLDVLLVFTLRDWFTRPEAEAPSWYRALADPVVGGALRAMHNAP
FT                   AAPWTVRSLAAHVGVSRAGLARRFTELVGEPPLTYLTCWRMDLAADLLRRPGATVTSVA
FT                   AQVGYADGFAFSSAFKRVRGISPRDHRRRAQTATADPDEQASPAIPTDSQPKVPSPVP"
     MDPLADLLHG VRAQGAQFCQ SILSPPWSLR FESTASLELH TMLHEDAWIV PDDGPVLRLR        60
     PGDIAVVRGP GRYVIADEPS TPPGLLVRDD RCFSIADGSD VGEALALGPR TFGSSADGSA       120
     TLVSGTYQLP DSLGERLLCA LPPVLVVPAV DDSCLELLEL VTAELVRDTP GQQIALDRML       180
     DVLLVFTLRD WFTRPEAEAP SWYRALADPV VGGALRAMHN APAAPWTVRS LAAHVGVSRA       240
     GLARRFTELV GEPPLTYLTC WRMDLAADLL RRPGATVTSV AAQVGYADGF AFSSAFKRVR       300
     GISPRDHRRR AQTATADPDE QASPAIPTDS QPKVPSPVP                              339
//

If you have problems or comments...

PBIL Back to PBIL home page