(data stored in ACNUC1104 zone)

EMBL: AM420293.PE677

AM420293.PE677       Location/Qualifiers
FT   CDS             758562..762005
FT                   /transl_table=11
FT                   /locus_tag="SACE_0690"
FT                   /product="putative signal transduction histidine kinase
FT                   membrane protein"
FT                   /function="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0690"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00032"
FT                   /db_xref="GOA:A4F7K8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7K8"
FT                   /protein_id="CAM00032.1"
FT                   /translation="MATGDTGRGAAVIRWRNWSLTTKLAAVVLVPVIFAITLGVGQIRW
FT                   QVDRADEYDRVAKVLDAVDQIEPLVVSVQEERTRSVDFLTGSIDAGKVDEQAVVVDAAV
FT                   RGTRQVMASPEDYSDVVRERFGELNTELGKLDETRALVRDRRAPAPAVIERYSKLVNSI
FT                   LSLNRALTSTVADRNLSSTASAMQDMVSIMEEVRLQQAWVLTGLAEGSISPQALDQLLG
FT                   SRARLIGKISEARATVAAHWQRRLDQTMTGTAILERNKLATAIVLETTDGKFSGGYSVP
FT                   RDQWNQRSDEVIQLIDEGHDDLGAEVRRIAFDLEDDASSAAGWDSVLLLSALILAAAII
FT                   ITIARQLLGSLRDLRRGALKSANKGLPEAVTSIRAGRKVDSELEPVGVDTDEEVGQVAR
FT                   AFDEVNRQALRLAVEQASLRRGYSEAFVSVSRRSQALLERQLRLFEELEKDEEDPDQLS
FT                   RLFQLDHLATRMRRNNENLMVLSGSDLARRFYQPTELADVLRAAVSEIEQYPRVIVQPP
FT                   PAVKLVGHAASDMVRLVAELLDNAANFSSPDTSVTVSSYQSGDGSVVLDVLDEGIGMGH
FT                   AELASANERLARVDEDDLATSRRMGLFVAGRLAVRHDIGVELHGGPDVEGVRATVTIPA
FT                   EHVVAGDAGRTAPPPPGQGVHRNGSTQHDLPNATSIPAQPAGDDQGFPAADFDPSPSLP
FT                   RRGVSEPTARAEFESSAPLPRRDPSGGLNALDSGSPLPRREPREPSLQQDHGAPATEGD
FT                   LSGPAPLFEPSQPSEAAEEQSESYGAAQQIPPEQPAEQTVNLFTPEPGGTSLDIPHQPR
FT                   TVGQDFAPAWPAVTEEPPRDQVADTSESPIFEEVSTQWFQPATDDAQAHATSGTAEHEF
FT                   AWPDSGQRDRSEVEVDELGLPVGPGAADGLARSDQPRSPGRWEDAGQSPAPSGWSEVGE
FT                   HRSPSGWDDADLARSSGDDADGARSSGGWGESRDPEDWSRSDESRSSDGWGLGAATGQV
FT                   EAGEPAEVGMSQEPAPLTTSGLPRRTPRGAAQAEGAGNSRSASDVSREFSEKYNGVHFG
FT                   QSEPAAPAEAGSAVEDAWNFAADDARRAAEAAVNPQPTSFTEAGLPRRTPKAHLAPGSV
FT                   NTPPGDEGGRFERDAEHLRSRLASFQSGSQRGRHRAPDEG"
     MATGDTGRGA AVIRWRNWSL TTKLAAVVLV PVIFAITLGV GQIRWQVDRA DEYDRVAKVL        60
     DAVDQIEPLV VSVQEERTRS VDFLTGSIDA GKVDEQAVVV DAAVRGTRQV MASPEDYSDV       120
     VRERFGELNT ELGKLDETRA LVRDRRAPAP AVIERYSKLV NSILSLNRAL TSTVADRNLS       180
     STASAMQDMV SIMEEVRLQQ AWVLTGLAEG SISPQALDQL LGSRARLIGK ISEARATVAA       240
     HWQRRLDQTM TGTAILERNK LATAIVLETT DGKFSGGYSV PRDQWNQRSD EVIQLIDEGH       300
     DDLGAEVRRI AFDLEDDASS AAGWDSVLLL SALILAAAII ITIARQLLGS LRDLRRGALK       360
     SANKGLPEAV TSIRAGRKVD SELEPVGVDT DEEVGQVARA FDEVNRQALR LAVEQASLRR       420
     GYSEAFVSVS RRSQALLERQ LRLFEELEKD EEDPDQLSRL FQLDHLATRM RRNNENLMVL       480
     SGSDLARRFY QPTELADVLR AAVSEIEQYP RVIVQPPPAV KLVGHAASDM VRLVAELLDN       540
     AANFSSPDTS VTVSSYQSGD GSVVLDVLDE GIGMGHAELA SANERLARVD EDDLATSRRM       600
     GLFVAGRLAV RHDIGVELHG GPDVEGVRAT VTIPAEHVVA GDAGRTAPPP PGQGVHRNGS       660
     TQHDLPNATS IPAQPAGDDQ GFPAADFDPS PSLPRRGVSE PTARAEFESS APLPRRDPSG       720
     GLNALDSGSP LPRREPREPS LQQDHGAPAT EGDLSGPAPL FEPSQPSEAA EEQSESYGAA       780
     QQIPPEQPAE QTVNLFTPEP GGTSLDIPHQ PRTVGQDFAP AWPAVTEEPP RDQVADTSES       840
     PIFEEVSTQW FQPATDDAQA HATSGTAEHE FAWPDSGQRD RSEVEVDELG LPVGPGAADG       900
     LARSDQPRSP GRWEDAGQSP APSGWSEVGE HRSPSGWDDA DLARSSGDDA DGARSSGGWG       960
     ESRDPEDWSR SDESRSSDGW GLGAATGQVE AGEPAEVGMS QEPAPLTTSG LPRRTPRGAA      1020
     QAEGAGNSRS ASDVSREFSE KYNGVHFGQS EPAAPAEAGS AVEDAWNFAA DDARRAAEAA      1080
     VNPQPTSFTE AGLPRRTPKA HLAPGSVNTP PGDEGGRFER DAEHLRSRLA SFQSGSQRGR      1140
     HRAPDEG                                                                1147
//

If you have problems or comments...

PBIL Back to PBIL home page