(data stored in ACNUC1104 zone)

EMBL: AM420293.PE683

AM420293.PE683       Location/Qualifiers
FT   CDS             complement(766308..767402)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0696"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0696"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00038"
FT                   /db_xref="GOA:A4F7L4"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7L4"
FT                   /protein_id="CAM00038.1"
FT                   /translation="MAVDVLSARDLNRATLHRQLLLERSTRTPVEAVEHLVGMQAQVPI
FT                   PPYFGLWTRLDGFAPDDLAQRLLDRSLVRIVLMRSTVHLVTADDCLTLRPLMQPPIDRD
FT                   LARNHPVGVEHREIAAYGRKLLDEKPRTLAQLRPLLAERWPQEDPARLGYAVRSLLPLV
FT                   QIPPRAVWGRSGQPTYATAETWLGRQLDPVPSLEDVVRRYLAAFGPATVADVQTWSGLI
FT                   GLRELVRGLGLRVFRDEHGRELFDLPDAPRPEPDVPAPPRFLPPYDNVLLSHADRTRIM
FT                   TERHRKLLFGANSGVFPGTVLLDGFVRGTWEISRQGTTAVLHVRPLARLSRRDSAALEA
FT                   EGRGLLGFAEESAEQHEVRFGAAE"
     MAVDVLSARD LNRATLHRQL LLERSTRTPV EAVEHLVGMQ AQVPIPPYFG LWTRLDGFAP        60
     DDLAQRLLDR SLVRIVLMRS TVHLVTADDC LTLRPLMQPP IDRDLARNHP VGVEHREIAA       120
     YGRKLLDEKP RTLAQLRPLL AERWPQEDPA RLGYAVRSLL PLVQIPPRAV WGRSGQPTYA       180
     TAETWLGRQL DPVPSLEDVV RRYLAAFGPA TVADVQTWSG LIGLRELVRG LGLRVFRDEH       240
     GRELFDLPDA PRPEPDVPAP PRFLPPYDNV LLSHADRTRI MTERHRKLLF GANSGVFPGT       300
     VLLDGFVRGT WEISRQGTTA VLHVRPLARL SRRDSAALEA EGRGLLGFAE ESAEQHEVRF       360
     GAAE                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page