(data stored in ACNUC1104 zone)

EMBL: AM420293.PE69

AM420293.PE69        Location/Qualifiers
FT   CDS             94800..95108
FT                   /transl_table=11
FT                   /locus_tag="SACE_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99424"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5V0"
FT                   /protein_id="CAL99424.1"
FT                   /translation="MEIANMRRAKLVPRWRGKRALRSAQVLDDVVNAQVALLPQLSPEA
FT                   RQRSADHLAEMVMLGQAYRHYAAGWISRRELERRGKAALRRMESTKRPPLEQLTERE"
     MEIANMRRAK LVPRWRGKRA LRSAQVLDDV VNAQVALLPQ LSPEARQRSA DHLAEMVMLG        60
     QAYRHYAAGW ISRRELERRG KAALRRMEST KRPPLEQLTE RE                          102
//

If you have problems or comments...

PBIL Back to PBIL home page