(data stored in ACNUC1104 zone)

EMBL: AM420293.PE694

AM420293.PE694       Location/Qualifiers
FT   CDS             775631..776035
FT                   /transl_table=11
FT                   /locus_tag="SACE_0707"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0707"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00049"
FT                   /db_xref="GOA:A4F7M5"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7M5"
FT                   /protein_id="CAM00049.1"
FT                   /translation="MAEVFAGFGAGLLVLGLAPVVTLLLVRPEGLLLREAARLAPGVAG
FT                   LLTGLARDGGVPRLVRLRLWLLLAYLAMPFDLEPDFAPALGLADDAVIVAVAMSTTLRR
FT                   VGFDAVERHWPDSRESFAVLRRLAPSAGTA"
     MAEVFAGFGA GLLVLGLAPV VTLLLVRPEG LLLREAARLA PGVAGLLTGL ARDGGVPRLV        60
     RLRLWLLLAY LAMPFDLEPD FAPALGLADD AVIVAVAMST TLRRVGFDAV ERHWPDSRES       120
     FAVLRRLAPS AGTA                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page