(data stored in ACNUC1104 zone)

EMBL: AM420293.PE73

AM420293.PE73        Location/Qualifiers
FT   CDS             complement(97869..98423)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99428"
FT                   /db_xref="GOA:A4F5V4"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5V4"
FT                   /protein_id="CAL99428.1"
FT                   /translation="MTIQLTPAKGALRVLRGAGLAITSASLSVAAHMTSGGSLPDPGTT
FT                   ALITALLSGAGVALAGRRRGLPSIVGALAVAQLALHVFLQLAGSHQGTPGHLVAPFDPV
FT                   GMSAGHALAALLTAVLLARAERALFVIARLLGLFLPPSQPRLLTVTKPGVIRAPARPVR
FT                   IPSHQAHLRRHPLRGPPAHSW"
     MTIQLTPAKG ALRVLRGAGL AITSASLSVA AHMTSGGSLP DPGTTALITA LLSGAGVALA        60
     GRRRGLPSIV GALAVAQLAL HVFLQLAGSH QGTPGHLVAP FDPVGMSAGH ALAALLTAVL       120
     LARAERALFV IARLLGLFLP PSQPRLLTVT KPGVIRAPAR PVRIPSHQAH LRRHPLRGPP       180
     AHSW                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page