(data stored in ACNUC1104 zone)

EMBL: AM420293.PE76

AM420293.PE76        Location/Qualifiers
FT   CDS             101030..102205
FT                   /transl_table=11
FT                   /locus_tag="SACE_0078"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /function="ABC-type proline/glycine betaine transport
FT                   systems, ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99431"
FT                   /db_xref="GOA:A4F5V7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5V7"
FT                   /protein_id="CAL99431.1"
FT                   /translation="MADNDIEMPGHGVEICLEEVSKRYHGQKQPAVESVTMTIPAGETV
FT                   VLVGPSGSGKTTTMRMINRLIEPTSGRITIGGQDVLGLDPDKLRREIGYSIQHAGLFPH
FT                   MTVGENVGMVPSLVGWDKSRIVERVEEMLDLVGLDPSEYRTRYPRQLSGGQQQRVGVAR
FT                   ALAANPPVLLMDEPFGAVDPITRGVLQDELMRLQADLGKTIVFVTHDFDEAVKLGDRIA
FT                   VLGDRSKILQYDTPEAILANPADDTVAGFVGAGAALKQLTLRRVREIELGQVPTAQADE
FT                   PPWALRERLGTRRGAIGLVLDKRKRPLRWATAREAGAVSSLDRAGRPVEDSVSPASTLQ
FT                   DALEAILTDDDGVAVVTGSRGEYVGVVDIDTVMNTIKALREEYADDQETES"
     MADNDIEMPG HGVEICLEEV SKRYHGQKQP AVESVTMTIP AGETVVLVGP SGSGKTTTMR        60
     MINRLIEPTS GRITIGGQDV LGLDPDKLRR EIGYSIQHAG LFPHMTVGEN VGMVPSLVGW       120
     DKSRIVERVE EMLDLVGLDP SEYRTRYPRQ LSGGQQQRVG VARALAANPP VLLMDEPFGA       180
     VDPITRGVLQ DELMRLQADL GKTIVFVTHD FDEAVKLGDR IAVLGDRSKI LQYDTPEAIL       240
     ANPADDTVAG FVGAGAALKQ LTLRRVREIE LGQVPTAQAD EPPWALRERL GTRRGAIGLV       300
     LDKRKRPLRW ATAREAGAVS SLDRAGRPVE DSVSPASTLQ DALEAILTDD DGVAVVTGSR       360
     GEYVGVVDID TVMNTIKALR EEYADDQETE S                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page