(data stored in SCRATCH zone)

EMBL: AM420293.PE78

AM420293.PE78        Location/Qualifiers
FT   CDS             102966..103961
FT                   /transl_table=11
FT                   /locus_tag="SACE_0080"
FT                   /product="possible glycine betaine/carnitine/choline
FT                   binding protein precursor"
FT                   /function="glycine betaine/choline-binding (lipo)protein of
FT                   an ABC-type transport system (osmoprotectant binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99433"
FT                   /db_xref="GOA:A4F5V9"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5V9"
FT                   /protein_id="CAL99433.1"
FT                   /translation="MNRRTALKLMSAGMAGMLVGGCGLSSGSAVPLPVAPGSIRPVPEL
FT                   EGVRITVGSKDFTEQIVLSYIAQFALDAAGANVRDLSNITGSASARNALASGQIDVLWE
FT                   YTGSSWISYNGNTDPIPDARRQYEAVRKLDLERNGIDWTAVTFDVDNTYAFAMTQEAAK
FT                   RLGVSKLSDVRRVVAENPQDATFCVDTEFASRNDGMPGVEQTYGFRADPAKIKTLTSGS
FT                   IYQATASGTCTFGEVFTTDGRIRSLNLKVLDDDRLFFPRYNLGVTLRADMLRQYPQITD
FT                   VLAPVSAQLNNVELMKLNAQVDVEGRDPADVARDWMVEKGFVTLPGRAAP"
     MNRRTALKLM SAGMAGMLVG GCGLSSGSAV PLPVAPGSIR PVPELEGVRI TVGSKDFTEQ        60
     IVLSYIAQFA LDAAGANVRD LSNITGSASA RNALASGQID VLWEYTGSSW ISYNGNTDPI       120
     PDARRQYEAV RKLDLERNGI DWTAVTFDVD NTYAFAMTQE AAKRLGVSKL SDVRRVVAEN       180
     PQDATFCVDT EFASRNDGMP GVEQTYGFRA DPAKIKTLTS GSIYQATASG TCTFGEVFTT       240
     DGRIRSLNLK VLDDDRLFFP RYNLGVTLRA DMLRQYPQIT DVLAPVSAQL NNVELMKLNA       300
     QVDVEGRDPA DVARDWMVEK GFVTLPGRAA P                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page