(data stored in ACNUC1104 zone)

EMBL: AM420293.PE79

AM420293.PE79        Location/Qualifiers
FT   CDS             complement(104011..104319)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99434"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5W0"
FT                   /protein_id="CAL99434.1"
FT                   /translation="MRAGFRFRHLPDADDVHALQGFRVLSGAMDVYLARAADDALGARY
FT                   RLEDLQGPSPAALWHRHGTVAEVVTALLELPEHGTPKAPKLAHARPDGLWVPHGANP"
     MRAGFRFRHL PDADDVHALQ GFRVLSGAMD VYLARAADDA LGARYRLEDL QGPSPAALWH        60
     RHGTVAEVVT ALLELPEHGT PKAPKLAHAR PDGLWVPHGA NP                          102
//

If you have problems or comments...

PBIL Back to PBIL home page