(data stored in SCRATCH zone)

EMBL: AM420293.PE85

AM420293.PE85        Location/Qualifiers
FT   CDS             109281..110915
FT                   /transl_table=11
FT                   /locus_tag="SACE_0087"
FT                   /product="hypothetical protein"
FT                   /function="predicted nuclease (RecB family)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99440"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5W6"
FT                   /protein_id="CAL99440.1"
FT                   /translation="MDDRVLLDAGVVTRCRRRVHLESDPAMREVEKAPPDPGIEQRIAD
FT                   ATEHRRFVAERLGRLLGDAWTEVPRELDAAERERLTVAAMNEGVRYISGAQLPLDRANG
FT                   RRGAVDLLVRGRDGYLPVLVVRHKITDPGSGARTSPLTDPNPASARTDERFKVRSHSRD
FT                   QLRLAHAVRMLEATGMGSAGATGGVIGVDADLVVWHDLRVPNWPGGRTALAEYDARFAD
FT                   RLAVASAAASGAEPLARPSRITECKGCPWWPTCERQLRTDRDVSLVVRGEDAVSLRAIG
FT                   VSTVDELARLSPEALETLPLTVARTGDVVLLAKAWLRELPLVRRVRRLSVPRADVEVDV
FT                   DMESYADSGAYMWGSWLSGADVGEEPGYRAFATWDPLPSDDEARSFAEFWSWFSSVRER
FT                   ALERGLTFRAYCYNELAENRWMLASAERFAGKPGVPPVAEVRAFIESDEWVDLFASVRD
FT                   QFLCPNGKGLKVIAPSAGFAWRDPEASGENSMRWYRDAVGLDGAPPVAAQRDRILRYNE
FT                   DDVRATWTIRRWMNSEAALAVPFAEDL"
     MDDRVLLDAG VVTRCRRRVH LESDPAMREV EKAPPDPGIE QRIADATEHR RFVAERLGRL        60
     LGDAWTEVPR ELDAAERERL TVAAMNEGVR YISGAQLPLD RANGRRGAVD LLVRGRDGYL       120
     PVLVVRHKIT DPGSGARTSP LTDPNPASAR TDERFKVRSH SRDQLRLAHA VRMLEATGMG       180
     SAGATGGVIG VDADLVVWHD LRVPNWPGGR TALAEYDARF ADRLAVASAA ASGAEPLARP       240
     SRITECKGCP WWPTCERQLR TDRDVSLVVR GEDAVSLRAI GVSTVDELAR LSPEALETLP       300
     LTVARTGDVV LLAKAWLREL PLVRRVRRLS VPRADVEVDV DMESYADSGA YMWGSWLSGA       360
     DVGEEPGYRA FATWDPLPSD DEARSFAEFW SWFSSVRERA LERGLTFRAY CYNELAENRW       420
     MLASAERFAG KPGVPPVAEV RAFIESDEWV DLFASVRDQF LCPNGKGLKV IAPSAGFAWR       480
     DPEASGENSM RWYRDAVGLD GAPPVAAQRD RILRYNEDDV RATWTIRRWM NSEAALAVPF       540
     AEDL                                                                    544
//

If you have problems or comments...

PBIL Back to PBIL home page