(data stored in ACNUC1104 zone)

EMBL: AM420293.PE86

AM420293.PE86        Location/Qualifiers
FT   CDS             complement(110943..111611)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99441"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5W7"
FT                   /protein_id="CAL99441.1"
FT                   /translation="MARKKPEWPEENAGTVRKYANRFDHEGALETLDMIRDELFGDSEA
FT                   MEALARQWGSDNTMTDSGLEIQRASNELAGYWQGGGYDAYTKHEFAVRGLFTNNETQMN
FT                   GISDVMLDCVELIYGTYADALRFISSCAHDLVSFSLADLIPGAGTIVKIIQVLNDFVKN
FT                   VSDLVAAAIEKMGTLMVKKGKLTTFANDFSGLGTDTGGPLVMPGAAGNPDAWNVKPIEA
FT                   "
     MARKKPEWPE ENAGTVRKYA NRFDHEGALE TLDMIRDELF GDSEAMEALA RQWGSDNTMT        60
     DSGLEIQRAS NELAGYWQGG GYDAYTKHEF AVRGLFTNNE TQMNGISDVM LDCVELIYGT       120
     YADALRFISS CAHDLVSFSL ADLIPGAGTI VKIIQVLNDF VKNVSDLVAA AIEKMGTLMV       180
     KKGKLTTFAN DFSGLGTDTG GPLVMPGAAG NPDAWNVKPI EA                          222
//

If you have problems or comments...

PBIL Back to PBIL home page