(data stored in ACNUC1104 zone)

EMBL: AM420293.PE87

AM420293.PE87        Location/Qualifiers
FT   CDS             complement(111623..111985)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99442"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5W8"
FT                   /protein_id="CAL99442.1"
FT                   /translation="MPGQVEGTGYSVVPESLRGTTTAWEESRDRWLLLASRMETEFYMP
FT                   DNAMGLLGREQNFPRTYNEARATIGRKLAEGADVLGGTSTDLDRVADEYEDRDYEYYKK
FT                   FGYLNDEMDDRVSGSF"
     MPGQVEGTGY SVVPESLRGT TTAWEESRDR WLLLASRMET EFYMPDNAMG LLGREQNFPR        60
     TYNEARATIG RKLAEGADVL GGTSTDLDRV ADEYEDRDYE YYKKFGYLND EMDDRVSGSF       120
//

If you have problems or comments...

PBIL Back to PBIL home page