(data stored in ACNUC1104 zone)

EMBL: AM420293.PKNA

AM420293.PKNA        Location/Qualifiers
FT   CDS             complement(61418..62728)
FT                   /transl_table=11
FT                   /gene="pknA"
FT                   /locus_tag="SACE_0045"
FT                   /product="putative serine/threonine protein kinase"
FT                   /function="15 Serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99398"
FT                   /db_xref="GOA:A4F5S4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5S4"
FT                   /protein_id="CAL99398.1"
FT                   /translation="MLTTGQLLAERYRLGQRIAVGGMGEVWKATDVRLDRTVAIKVLKA
FT                   ELCGNAEFLHRFRTEARTTASLNHPGIAAVHDYGETAAIPDGPEDTAYLVMELVEGEPL
FT                   AATLAREGRIKAEHALDMLEQAGHALQAAHERGLVHRDVKPGNILITPNGKVKLTDFGI
FT                   AKAADAAPVTRSGMVMGTAHYIAPEQALGSEATPASDVYSLAVVGYECLKGHRPFLSDN
FT                   AVTVAMMHIREVAPPLPPDVPPGARALIEATLVKDPRRRYATGGEFANAVAAVRAGLPL
FT                   PTPAALAVPQQRQQMGTPVPGTGVHQLPPAMPPMQNTYPPGLIPPQAAAPQPPPPAPRP
FT                   RYSRTMIWVAVSVVVVVALTAIGIAVALRTTNGQGVPHNDPERTRQVAAGAATNHLDSA
FT                   DRFDQTALRPVRGTNRTNTHQSTEVGGTAHGVQRGTS"
     MLTTGQLLAE RYRLGQRIAV GGMGEVWKAT DVRLDRTVAI KVLKAELCGN AEFLHRFRTE        60
     ARTTASLNHP GIAAVHDYGE TAAIPDGPED TAYLVMELVE GEPLAATLAR EGRIKAEHAL       120
     DMLEQAGHAL QAAHERGLVH RDVKPGNILI TPNGKVKLTD FGIAKAADAA PVTRSGMVMG       180
     TAHYIAPEQA LGSEATPASD VYSLAVVGYE CLKGHRPFLS DNAVTVAMMH IREVAPPLPP       240
     DVPPGARALI EATLVKDPRR RYATGGEFAN AVAAVRAGLP LPTPAALAVP QQRQQMGTPV       300
     PGTGVHQLPP AMPPMQNTYP PGLIPPQAAA PQPPPPAPRP RYSRTMIWVA VSVVVVVALT       360
     AIGIAVALRT TNGQGVPHND PERTRQVAAG AATNHLDSAD RFDQTALRPV RGTNRTNTHQ       420
     STEVGGTAHG VQRGTS                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page