(data stored in ACNUC1104 zone)

EMBL: AM420293.PKNB

AM420293.PKNB        Location/Qualifiers
FT   CDS             complement(59398..61359)
FT                   /transl_table=11
FT                   /gene="pknB"
FT                   /locus_tag="SACE_0044"
FT                   /product="serine/threonine protein kinase"
FT                   /function="15 Serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99397"
FT                   /db_xref="GOA:A4F5S3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5S3"
FT                   /protein_id="CAL99397.1"
FT                   /translation="MSSPRLLSNRYEIGDTLGYGGMSEVHRGRDIRLGRDVAVKVLRAD
FT                   LARDPTFQLRFRREAQNAAALNHPAIVAVYDTGETDSENGPLPYIVMEYVDGRTLRDIV
FT                   KSEGPLAPRRAMEVMADASAALDFSHRHHIIHRDVKPANIMITRSGAVKVMDFGIARAL
FT                   TDGQAAVTQTAAVIGTAQYLSPEQARGESVDARSDVYASGCVLFELLTGEPPFTGDSPV
FT                   AVAYQHVREDPRKPSDVNQQVPASLDAVVLKALSKNPANRYQSAAEMRADLVRVLSGQR
FT                   PKAPMIMSEEERTSMIAPAPATEVMAPGGRHRSVEPAVEDDLDAEQQRKRRKNWLIALV
FT                   TLICVAVFALVAWVANALLSGPSGDDKIAVPQLEGMTKSQALSELTAGNWLWQEQIPCP
FT                   SSREDVGRVINQTPDPGVPIDKKQDRIRVCFGTGPEQVQIPDLRGMSMDQASAKLSEVG
FT                   LMLGYNPKTREVDNDSQVDKILEWDPEGTVAKGTTINVVLGKKAEQRAVPDVRNMPYET
FT                   AERMLSYAGFQVQRSDRDSSEPAGIVVDQTPAADTKLKPGSKVTVYVSNGQQISMPPLT
FT                   GLSPTDAKRQLQQLGWNGQLVEQKESTSDSKLDGKVMRSSPSGGDKISKNQTITIYVGE
FT                   YDSSPTTQPDDGFFPPFP"
     MSSPRLLSNR YEIGDTLGYG GMSEVHRGRD IRLGRDVAVK VLRADLARDP TFQLRFRREA        60
     QNAAALNHPA IVAVYDTGET DSENGPLPYI VMEYVDGRTL RDIVKSEGPL APRRAMEVMA       120
     DASAALDFSH RHHIIHRDVK PANIMITRSG AVKVMDFGIA RALTDGQAAV TQTAAVIGTA       180
     QYLSPEQARG ESVDARSDVY ASGCVLFELL TGEPPFTGDS PVAVAYQHVR EDPRKPSDVN       240
     QQVPASLDAV VLKALSKNPA NRYQSAAEMR ADLVRVLSGQ RPKAPMIMSE EERTSMIAPA       300
     PATEVMAPGG RHRSVEPAVE DDLDAEQQRK RRKNWLIALV TLICVAVFAL VAWVANALLS       360
     GPSGDDKIAV PQLEGMTKSQ ALSELTAGNW LWQEQIPCPS SREDVGRVIN QTPDPGVPID       420
     KKQDRIRVCF GTGPEQVQIP DLRGMSMDQA SAKLSEVGLM LGYNPKTREV DNDSQVDKIL       480
     EWDPEGTVAK GTTINVVLGK KAEQRAVPDV RNMPYETAER MLSYAGFQVQ RSDRDSSEPA       540
     GIVVDQTPAA DTKLKPGSKV TVYVSNGQQI SMPPLTGLSP TDAKRQLQQL GWNGQLVEQK       600
     ESTSDSKLDG KVMRSSPSGG DKISKNQTIT IYVGEYDSSP TTQPDDGFFP PFP              653
//

If you have problems or comments...

PBIL Back to PBIL home page