(data stored in ACNUC1104 zone)

EMBL: AM420293.RADA

AM420293.RADA        Location/Qualifiers
FT   CDS             complement(489734..491116)
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="SACE_0436"
FT                   /product="DNA repair protein"
FT                   /function="predicted ATP-dependent serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99784"
FT                   /db_xref="GOA:A4F6W0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6W0"
FT                   /protein_id="CAL99784.1"
FT                   /translation="MPAKNARTARPGFRCADCGHEVAKWVGRCPSCQAWGTIDEAAAAR
FT                   PALAKVAAGAPATPARPIAEVDLDSARAVSTGIGELDRVLGGGIVPGAVVLMAGEPGVG
FT                   KSTLLLEVAHRWAATGGGGPSLYVTGEESAGQVRLRAERTDSVHPQLYLGAESDLGSVL
FT                   GHVDSVKPGLLIVDSVQTVQSPEAEGSPGGVTQVRAVTSALVALAKERGLPVLLVGHVT
FT                   KDGAVAGPRVLEHLVDVVLHFEGDRHSSLRMLRGVKNRFGPSDEVGCFEQRDDGIAEVA
FT                   DPSGLFVNRQETQVEGTAVTVMVEGKRPLLAEVQALVTPTQMTMPRRAVSGLDSARVSM
FT                   MLAVLDKHGGVKTGDQEVFAATVGGMKVSEPAADLAVALAVASSRRGVPLPSNVIAVGE
FT                   VGLAGEIRRVNAVGRRLAEAARLGFDHALVPPDSGPLPRGVRTTVVPDIRAALRVLKRA
FT                   RT"
     MPAKNARTAR PGFRCADCGH EVAKWVGRCP SCQAWGTIDE AAAARPALAK VAAGAPATPA        60
     RPIAEVDLDS ARAVSTGIGE LDRVLGGGIV PGAVVLMAGE PGVGKSTLLL EVAHRWAATG       120
     GGGPSLYVTG EESAGQVRLR AERTDSVHPQ LYLGAESDLG SVLGHVDSVK PGLLIVDSVQ       180
     TVQSPEAEGS PGGVTQVRAV TSALVALAKE RGLPVLLVGH VTKDGAVAGP RVLEHLVDVV       240
     LHFEGDRHSS LRMLRGVKNR FGPSDEVGCF EQRDDGIAEV ADPSGLFVNR QETQVEGTAV       300
     TVMVEGKRPL LAEVQALVTP TQMTMPRRAV SGLDSARVSM MLAVLDKHGG VKTGDQEVFA       360
     ATVGGMKVSE PAADLAVALA VASSRRGVPL PSNVIAVGEV GLAGEIRRVN AVGRRLAEAA       420
     RLGFDHALVP PDSGPLPRGV RTTVVPDIRA ALRVLKRART                             460
//

If you have problems or comments...

PBIL Back to PBIL home page