(data stored in ACNUC1104 zone)

EMBL: AM420293.RECF

AM420293.RECF        Location/Qualifiers
FT   CDS             5261..6436
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="SACE_0005"
FT                   /product="DNA replication and repair protein"
FT                   /function="Recombinational DNA repair ATPase (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99359"
FT                   /db_xref="GOA:A4F5N5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F5N5"
FT                   /protein_id="CAL99359.1"
FT                   /translation="MYVRHLQVTDFRSWPHADLTFEPGPTVLVGSNGQGKTNLVEALGY
FT                   VATLGSHRVATDAPLVRYGTQRAVVRAAVVNHGRELLVELEITPGKANRARINRGAAGK
FT                   PRDVLGILRTVLFAPEDMAMVRGDPGERRRFLDDLLVARAPRYAGVRSDYDRVLRQRSA
FT                   LLKSAGAAKRGGSGGDLRTLEVWDGHLARYGAELLAGRLDLVAAIAPHVTSAYANVAAT
FT                   AEETAPSGRVADVRYRSSLGESLPEGYGVPRGEPADVEVLEKALLAELERVRAQELERG
FT                   VSLVGPHRDDLELMLGELPAKGYASHGESWSFALALRLASYHLLAEDGAEPVLILDDVF
FT                   AELDRRRRSRLAELVAGAEQVLVTAAVAEDVPEELTGVRFDVREGEVRRVE"
     MYVRHLQVTD FRSWPHADLT FEPGPTVLVG SNGQGKTNLV EALGYVATLG SHRVATDAPL        60
     VRYGTQRAVV RAAVVNHGRE LLVELEITPG KANRARINRG AAGKPRDVLG ILRTVLFAPE       120
     DMAMVRGDPG ERRRFLDDLL VARAPRYAGV RSDYDRVLRQ RSALLKSAGA AKRGGSGGDL       180
     RTLEVWDGHL ARYGAELLAG RLDLVAAIAP HVTSAYANVA ATAEETAPSG RVADVRYRSS       240
     LGESLPEGYG VPRGEPADVE VLEKALLAEL ERVRAQELER GVSLVGPHRD DLELMLGELP       300
     AKGYASHGES WSFALALRLA SYHLLAEDGA EPVLILDDVF AELDRRRRSR LAELVAGAEQ       360
     VLVTAAVAED VPEELTGVRF DVREGEVRRV E                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page