(data stored in ACNUC1104 zone)

EMBL: AM420293.SPEE

AM420293.SPEE        Location/Qualifiers
FT   CDS             complement(508722..510314)
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="SACE_0456"
FT                   /product="putative spermidine synthase"
FT                   /function="predicted spermidine synthase with an N-terminal
FT                   membrane domain"
FT                   /EC_number="2.5.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99804"
FT                   /db_xref="GOA:A4F6Y0"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Y0"
FT                   /protein_id="CAL99804.1"
FT                   /translation="MSVSTEPRDETEPAAAPRPRGRLARTAVLVAVFVCAACGLVYELA
FT                   LVALGSYLIGDTIGQASIVLSLMVFAMGVGALAAKPLQRWAAAAFALVELVLALLGGLS
FT                   VLLLYAAFAWVGLYLPALIVTALVLGALIGAEIPLLMVLLQRIRKQDAGSAVADLFAAD
FT                   YVGGLVGGLAFPFLLLPLFGQIQGALLVGMLNAAAGLGLVLTVFRRELSKRVRLVLVAA
FT                   SALVGGVLLVAYVFADDFEVTARQALYADPVVHAERTDYQDVVLTERVSLSGRGDTRLF
FT                   LNGDLQFSSVDEYRYHEALVHPAMAGPRSRVLVLGGGDGLALREVLRYPDVQQVTLVEM
FT                   DPAVLDLAREDPRVAGLNRHAFDDPRVRTVSADAFAWLRDNRERYDVVLVDMPDPDSTA
FT                   TAKLYSTEFYALVRHAMADGARVNVQAGSPYFAPQAFWCIEATTRAAGISTVPYEVSVP
FT                   SFGEWGFHLGTAGAAPPLELPAGAPPLRSLDAGTLRAAAEFPPDRRRIPGMEPSTLMHP
FT                   TILSYAQGEWTNY"
     MSVSTEPRDE TEPAAAPRPR GRLARTAVLV AVFVCAACGL VYELALVALG SYLIGDTIGQ        60
     ASIVLSLMVF AMGVGALAAK PLQRWAAAAF ALVELVLALL GGLSVLLLYA AFAWVGLYLP       120
     ALIVTALVLG ALIGAEIPLL MVLLQRIRKQ DAGSAVADLF AADYVGGLVG GLAFPFLLLP       180
     LFGQIQGALL VGMLNAAAGL GLVLTVFRRE LSKRVRLVLV AASALVGGVL LVAYVFADDF       240
     EVTARQALYA DPVVHAERTD YQDVVLTERV SLSGRGDTRL FLNGDLQFSS VDEYRYHEAL       300
     VHPAMAGPRS RVLVLGGGDG LALREVLRYP DVQQVTLVEM DPAVLDLARE DPRVAGLNRH       360
     AFDDPRVRTV SADAFAWLRD NRERYDVVLV DMPDPDSTAT AKLYSTEFYA LVRHAMADGA       420
     RVNVQAGSPY FAPQAFWCIE ATTRAAGIST VPYEVSVPSF GEWGFHLGTA GAAPPLELPA       480
     GAPPLRSLDA GTLRAAAEFP PDRRRIPGME PSTLMHPTIL SYAQGEWTNY                  530
//

If you have problems or comments...

PBIL Back to PBIL home page