(data stored in ACNUC1104 zone)

EMBL: AM420293.THIC

AM420293.THIC        Location/Qualifiers
FT   CDS             complement(565000..566643)
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="SACE_0511"
FT                   /product="putative thiamine biosynthesis protein"
FT                   /function="Thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99857"
FT                   /db_xref="GOA:A4F733"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:A4F733"
FT                   /protein_id="CAL99857.1"
FT                   /translation="MADVRPNLSSDHHSVTTGPISGSRKVHHTTESGLKVPFRRIELSN
FT                   GEHLDVYDTSGAYTDDDVQVDVHSGLHRLRAGWTDGREHRTQLGWAKAGVVTREMEFIA
FT                   AREGVSPEFVRDEVASGRAVIPANRCHPESEPMIIGKNFLVKVNANIGNSAVTSSVEEE
FT                   VEKMVWATRWGADTVMDLSTGKRIHETREQILRNSPVPIGTVPIYQALEKVNGDPEKLT
FT                   WEIYRDTVIEQCEQGVDYMTVHAGVLLRYVPLTAQRVTGIVSRGGSIMAAWCLAHHRES
FT                   FLYTHFSELCEILRDYDVTFSLGDGLRPGSIADANDRAQFAELETLGELTHIARDMDVQ
FT                   VMIEGPGHVPMHKIVENVKLEEELCGEAPFYTLGPLTTDIAPAYDHITSGIGAAVIAQA
FT                   GTAMLCYVTPKEHLGLPNRDDVKVGVITYKIAAHAADLAKGHPRAQDWDDALSKARFEF
FT                   RWNDQFNLSLDPDTARAYHDETLPAEPAKTAHFCSMCGPKFCSMKITQDVRKYAEERGL
FT                   TSVEAIEAGMREKSDEFSESGGKVYLPVVG"
     MADVRPNLSS DHHSVTTGPI SGSRKVHHTT ESGLKVPFRR IELSNGEHLD VYDTSGAYTD        60
     DDVQVDVHSG LHRLRAGWTD GREHRTQLGW AKAGVVTREM EFIAAREGVS PEFVRDEVAS       120
     GRAVIPANRC HPESEPMIIG KNFLVKVNAN IGNSAVTSSV EEEVEKMVWA TRWGADTVMD       180
     LSTGKRIHET REQILRNSPV PIGTVPIYQA LEKVNGDPEK LTWEIYRDTV IEQCEQGVDY       240
     MTVHAGVLLR YVPLTAQRVT GIVSRGGSIM AAWCLAHHRE SFLYTHFSEL CEILRDYDVT       300
     FSLGDGLRPG SIADANDRAQ FAELETLGEL THIARDMDVQ VMIEGPGHVP MHKIVENVKL       360
     EEELCGEAPF YTLGPLTTDI APAYDHITSG IGAAVIAQAG TAMLCYVTPK EHLGLPNRDD       420
     VKVGVITYKI AAHAADLAKG HPRAQDWDDA LSKARFEFRW NDQFNLSLDP DTARAYHDET       480
     LPAEPAKTAH FCSMCGPKFC SMKITQDVRK YAEERGLTSV EAIEAGMREK SDEFSESGGK       540
     VYLPVVG                                                                 547
//

If you have problems or comments...

PBIL Back to PBIL home page