(data stored in ACNUC1104 zone)

EMBL: AM420293.THID

AM420293.THID        Location/Qualifiers
FT   CDS             complement(564036..564902)
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="SACE_0510"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /function="Hydroxymethylpyrimidine/phosphomethylpyrimidine
FT                   kinase"
FT                   /EC_number="2.7.4.7"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99856"
FT                   /db_xref="GOA:A4F732"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A4F732"
FT                   /protein_id="CAL99856.1"
FT                   /translation="MHETPAGHEIQPANDPAPPTALTIAGSDSGGSAGMHADLRTFFAC
FT                   GVHGMTAVTAVTVQNTVGVTGLVEIPPETVAAQVDAVASDIGVDAAKTGVLASAATIEA
FT                   VMAVCDNHGIGRGGRTPFVVDPVAASRSGEPLLRPDALDALRNEAFPRATLVTPNLDEV
FT                   RLLTGFDARTRADLLDAAKAIYDFGPQWVLIKSGHLPDDPECVDLLYDGSQATPLPGPR
FT                   YSTVHTHGAGDAFASSITAALAKGASMPDAVRLGKRFVTRSVEHAYPLGAGIGPVSTFW
FT                   RVSPRSF"
     MHETPAGHEI QPANDPAPPT ALTIAGSDSG GSAGMHADLR TFFACGVHGM TAVTAVTVQN        60
     TVGVTGLVEI PPETVAAQVD AVASDIGVDA AKTGVLASAA TIEAVMAVCD NHGIGRGGRT       120
     PFVVDPVAAS RSGEPLLRPD ALDALRNEAF PRATLVTPNL DEVRLLTGFD ARTRADLLDA       180
     AKAIYDFGPQ WVLIKSGHLP DDPECVDLLY DGSQATPLPG PRYSTVHTHG AGDAFASSIT       240
     AALAKGASMP DAVRLGKRFV TRSVEHAYPL GAGIGPVSTF WRVSPRSF                    288
//

If you have problems or comments...

PBIL Back to PBIL home page