(data stored in ACNUC1104 zone)

EMBL: AM420293.THIG

AM420293.THIG        Location/Qualifiers
FT   CDS             561006..561770
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="SACE_0508"
FT                   /product="thiamine synthesis, thiazole moiety"
FT                   /function="uncharacterized enzyme of thiazole biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99854"
FT                   /db_xref="GOA:A4F730"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:A4F730"
FT                   /protein_id="CAL99854.1"
FT                   /translation="MDDPLVIAGREFGSRLITGTGGAANLAVLERALIASGTELTTVAM
FT                   RRADAGGRTGVLDLLRKLGIEALPNTAGCRTAAEAVLTAQLAREALGTNWVKLEVVADE
FT                   DTLLPDPVELLDAAEQLVDQGFVVLAYTNDDPVLALRLEETGCAAVMPLGSPIGTGLGI
FT                   RNPHNIEMIVSRASVPIVLDAGIGTASDAALAMELGCDAVLLATAVTRAQDPERMAAAM
FT                   RAAVDAGRLASQAGRIPQRFWAQASSPGRPTG"
     MDDPLVIAGR EFGSRLITGT GGAANLAVLE RALIASGTEL TTVAMRRADA GGRTGVLDLL        60
     RKLGIEALPN TAGCRTAAEA VLTAQLAREA LGTNWVKLEV VADEDTLLPD PVELLDAAEQ       120
     LVDQGFVVLA YTNDDPVLAL RLEETGCAAV MPLGSPIGTG LGIRNPHNIE MIVSRASVPI       180
     VLDAGIGTAS DAALAMELGC DAVLLATAVT RAQDPERMAA AMRAAVDAGR LASQAGRIPQ       240
     RFWAQASSPG RPTG                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page