(data stored in ACNUC1104 zone)

EMBL: AM420293.UREB

AM420293.UREB        Location/Qualifiers
FT   CDS             697890..698258
FT                   /transl_table=11
FT                   /gene="ureB"
FT                   /locus_tag="SACE_0635"
FT                   /product="urease beta subunit"
FT                   /function="Urea amidohydrolase (urease) beta subunit"
FT                   /EC_number="3.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0635"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99980"
FT                   /db_xref="GOA:A4F7F6"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F7F6"
FT                   /protein_id="CAL99980.1"
FT                   /translation="MRPGEIITGDGPVPLNPGRPRVRITVVNRADRAVQVGSHYHFAAV
FT                   NEGLEFDRAAAWGHRLDVPAGTAVRFEPGVEREVRLVPVGGSRRVPGLRPEYAGELDGR
FT                   GHEPTAPNYGEKGQGHFE"
     MRPGEIITGD GPVPLNPGRP RVRITVVNRA DRAVQVGSHY HFAAVNEGLE FDRAAAWGHR        60
     LDVPAGTAVR FEPGVEREVR LVPVGGSRRV PGLRPEYAGE LDGRGHEPTA PNYGEKGQGH       120
     FE                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page